| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (165 species) not a true protein |
| Species Scaptomyza nigrita [TaxId:928823] [229396] (1 PDB entry) |
| Domain d4i97b1: 4i97 B:2-85 [234839] Other proteins in same PDB: d4i97a2, d4i97b2 automated match to d4i97a1 complexed with gsh |
PDB Entry: 4i97 (more details), 2.15 Å
SCOPe Domain Sequences for d4i97b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i97b1 c.47.1.0 (B:2-85) automated matches {Scaptomyza nigrita [TaxId: 928823]}
adlyylpgsspcrsvimvakaiglelnkklldlstgehlkpefvkinpqhtiptlvdngf
alwesrailvylvekygktdslyp
Timeline for d4i97b1: