Lineage for d4i97b1 (4i97 B:2-85)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134950Species Scaptomyza nigrita [TaxId:928823] [229396] (1 PDB entry)
  8. 2134952Domain d4i97b1: 4i97 B:2-85 [234839]
    Other proteins in same PDB: d4i97a2, d4i97b2
    automated match to d4i97a1
    complexed with gsh

Details for d4i97b1

PDB Entry: 4i97 (more details), 2.15 Å

PDB Description: The crystal structure of glutathione S-transferase SnigGSTD1A from Scaptomyza nigrita in complex with glutathione
PDB Compounds: (B:) delta class 1 glutathione s-transferase

SCOPe Domain Sequences for d4i97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i97b1 c.47.1.0 (B:2-85) automated matches {Scaptomyza nigrita [TaxId: 928823]}
adlyylpgsspcrsvimvakaiglelnkklldlstgehlkpefvkinpqhtiptlvdngf
alwesrailvylvekygktdslyp

SCOPe Domain Coordinates for d4i97b1:

Click to download the PDB-style file with coordinates for d4i97b1.
(The format of our PDB-style files is described here.)

Timeline for d4i97b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i97b2