SCOPe 2.03: Domain d4i97b1: 4i97 B:2-85

Lineage for d4i97b1 (4i97 B:2-85)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Scaptomyza nigrita [TaxId:928823] [229396] (1 PDB entry)

8. Domain d4i97b1: 4i97 B:2-85 [234839]
   Other proteins in same PDB: d4i97a2, d4i97b2
   automated match to d4i97a1
   complexed with gsh

Details for d4i97b1

PDB Entry: 4i97, 2.15 Å

PDB Description: The crystal structure of glutathione S-transferase SnigGSTD1A from Scaptomyza nigrita in complex with glutathione

PDB Compounds: (B:) delta class 1 glutathione s-transferase

SCOPe Domain Sequences for d4i97b1:

Sequence; same for both SEQRES and ATOM records:

>d4i97b1 c.47.1.0 (B:2-85) automated matches {Scaptomyza nigrita [TaxId: 928823]}
adlyylpgsspcrsvimvakaiglelnkklldlstgehlkpefvkinpqhtiptlvdngf
alwesrailvylvekygktdslyp

Timeline for d4i97b1:

• d4i97b1 is new in SCOPe 2.03-stable
  
• d4i97b1 appears in SCOPe 2.04
  
• d4i97b1 appears in the current release, SCOPe 2.08