Lineage for d4i0cc_ (4i0c C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512733Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)
  8. 1512750Domain d4i0cc_: 4i0c C: [234758]
    Other proteins in same PDB: d4i0ca_, d4i0cb_
    automated match to d4i0cd_
    complexed with cl, gol

Details for d4i0cc_

PDB Entry: 4i0c (more details), 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme
PDB Compounds: (C:) cAbHuL5 antibody

SCOPe Domain Sequences for d4i0cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i0cc_ b.1.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyads
vkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgtq
vtvssh

SCOPe Domain Coordinates for d4i0cc_:

Click to download the PDB-style file with coordinates for d4i0cc_.
(The format of our PDB-style files is described here.)

Timeline for d4i0cc_: