Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries) |
Domain d4i0cc_: 4i0c C: [234758] Other proteins in same PDB: d4i0ca_, d4i0cb_ automated match to d4i0cd_ complexed with cl, gol |
PDB Entry: 4i0c (more details), 1.95 Å
SCOPe Domain Sequences for d4i0cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i0cc_ b.1.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} vqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyads vkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgtq vtvssh
Timeline for d4i0cc_: