Lineage for d4hyra1 (4hyr A:1-133)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649265Species Acidaminococcus sp. [TaxId:563191] [234733] (1 PDB entry)
  8. 1649266Domain d4hyra1: 4hyr A:1-133 [234734]
    Other proteins in same PDB: d4hyra2, d4hyrb2
    automated match to d4g8ta1
    complexed with cl, edo, gol

Details for d4hyra1

PDB Entry: 4hyr (more details), 1.84 Å

PDB Description: structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d4hyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hyra1 d.54.1.0 (A:1-133) automated matches {Acidaminococcus sp. [TaxId: 563191]}
lvpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittal
envsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcldll
gkaldmpvcrllg

SCOPe Domain Coordinates for d4hyra1:

Click to download the PDB-style file with coordinates for d4hyra1.
(The format of our PDB-style files is described here.)

Timeline for d4hyra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hyra2