SCOPe 2.08: Domain d4hyra1: 4hyr A:2-133

Lineage for d4hyra1 (4hyr A:2-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Acidaminococcus sp. [TaxId:563191] [234733] (1 PDB entry)

8. Domain d4hyra1: 4hyr A:2-133 [234734]
   Other proteins in same PDB: d4hyra2, d4hyra3, d4hyrb2, d4hyrb3
   automated match to d4g8ta1
   complexed with cl, edo, gol

Details for d4hyra1

PDB Entry: 4hyr, 1.84 Å

PDB Description: structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d4hyra1:

Sequence; same for both SEQRES and ATOM records:

>d4hyra1 d.54.1.0 (A:2-133) automated matches {Acidaminococcus sp. [TaxId: 563191]}
vpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittale
nvsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcldllg
kaldmpvcrllg

Timeline for d4hyra1:

• d4hyra1 first appeared in SCOPe 2.03
  
• d4hyra1 appears in SCOPe 2.07