Lineage for d4hx3b_ (4hx3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962415Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 2962416Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 2962426Family d.84.1.0: automated matches [193339] (1 protein)
    not a true family
  6. 2962427Protein automated matches [193340] (2 species)
    not a true protein
  7. 2962428Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)
  8. 2962432Domain d4hx3b_: 4hx3 B: [234725]
    Other proteins in same PDB: d4hx3a1, d4hx3a2, d4hx3c1, d4hx3c2, d4hx3e1, d4hx3e2, d4hx3g1, d4hx3g2, d4hx3h2, d4hx3i1, d4hx3i2, d4hx3k1, d4hx3k2
    automated match to d4hx3d_
    complexed with gol, zn

Details for d4hx3b_

PDB Entry: 4hx3 (more details), 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin
PDB Compounds: (B:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx3b_ d.84.1.0 (B:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

SCOPe Domain Coordinates for d4hx3b_:

Click to download the PDB-style file with coordinates for d4hx3b_.
(The format of our PDB-style files is described here.)

Timeline for d4hx3b_: