Lineage for d4hx3c1 (4hx3 C:2-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963582Family d.92.1.1: Zinc protease [55487] (2 proteins)
    single domain
    automatically mapped to Pfam PF02031
  6. 2963587Protein automated matches [194246] (1 species)
    not a true protein
  7. 2963588Species Streptomyces caespitosus [TaxId:53502] [194247] (1 PDB entry)
  8. 2963590Domain d4hx3c1: 4hx3 C:2-132 [202505]
    Other proteins in same PDB: d4hx3a2, d4hx3b_, d4hx3c2, d4hx3d_, d4hx3e2, d4hx3f_, d4hx3g2, d4hx3h1, d4hx3h2, d4hx3i2, d4hx3j_, d4hx3k2, d4hx3l_
    automated match to d4hx3i_
    complexed with gol, zn

Details for d4hx3c1

PDB Entry: 4hx3 (more details), 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin
PDB Compounds: (C:) Extracellular small neutral protease

SCOPe Domain Sequences for d4hx3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx3c1 d.92.1.1 (C:2-132) automated matches {Streptomyces caespitosus [TaxId: 53502]}
vtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdghg
rgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaqe
rsrvnalwang

SCOPe Domain Coordinates for d4hx3c1:

Click to download the PDB-style file with coordinates for d4hx3c1.
(The format of our PDB-style files is described here.)

Timeline for d4hx3c1: