SCOPe 2.08: Domain d4hx3g1: 4hx3 G:1-132

Lineage for d4hx3g1 (4hx3 G:1-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.1: Zinc protease [55487] (2 proteins)
   single domain
   automatically mapped to Pfam PF02031

6. Protein automated matches [194246] (1 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [194247] (1 PDB entry)

8. Domain d4hx3g1: 4hx3 G:1-132 [202507]
   Other proteins in same PDB: d4hx3a2, d4hx3b_, d4hx3c2, d4hx3d_, d4hx3e2, d4hx3f_, d4hx3g2, d4hx3h1, d4hx3h2, d4hx3i2, d4hx3j_, d4hx3k2, d4hx3l_
   automated match to d4hx3k_
   complexed with gol, zn

Details for d4hx3g1

PDB Entry: 4hx3, 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin

PDB Compounds: (G:) Extracellular small neutral protease

SCOPe Domain Sequences for d4hx3g1:

Sequence; same for both SEQRES and ATOM records:

>d4hx3g1 d.92.1.1 (G:1-132) automated matches {Streptomyces caespitosus [TaxId: 53502]}
mvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang

Timeline for d4hx3g1:

• d4hx3g1 first appeared in SCOPe 2.03, called d4hx3g_
  
• d4hx3g1 appears in SCOPe 2.07