Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) |
Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
Protein automated matches [193340] (1 species) not a true protein |
Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries) |
Domain d4hwxa1: 4hwx A:1-113 [234723] Other proteins in same PDB: d4hwxa2 automated match to d4hx3d_ complexed with act, gol |
PDB Entry: 4hwx (more details), 1.9 Å
SCOPe Domain Sequences for d4hwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwxa1 d.84.1.0 (A:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]} sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
Timeline for d4hwxa1: