SCOPe 2.06: Domain d4hwxa1: 4hwx A:1-113

Lineage for d4hwxa1 (4hwx A:1-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.0: automated matches [193339] (1 protein)
   not a true family

6. Protein automated matches [193340] (1 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)

8. Domain d4hwxa1: 4hwx A:1-113 [234723]
   Other proteins in same PDB: d4hwxa2
   automated match to d4hx3d_
   complexed with act, gol

Details for d4hwxa1

PDB Entry: 4hwx, 1.9 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin

PDB Compounds: (A:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hwxa1:

Sequence; same for both SEQRES and ATOM records:

>d4hwxa1 d.84.1.0 (A:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Timeline for d4hwxa1:

• d4hwxa1 first appeared in SCOPe 2.03, called d4hwxa_
  
• d4hwxa1 was called d4hwxa_ in SCOPe 2.05
  
• d4hwxa1 appears in SCOPe 2.07
  
• d4hwxa1 appears in the current release, SCOPe 2.08