SCOPe 2.05: Domain d4hwxa_: 4hwx A:

Lineage for d4hwxa_ (4hwx A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.0: automated matches [193339] (1 protein)
   not a true family

6. Protein automated matches [193340] (1 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)

8. Domain d4hwxa_: 4hwx A: [234723]
   automated match to d4hx3d_
   complexed with act, gol

Details for d4hwxa_

PDB Entry: 4hwx, 1.9 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin

PDB Compounds: (A:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hwxa_:

Sequence; same for both SEQRES and ATOM records:

>d4hwxa_ d.84.1.0 (A:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
laapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Timeline for d4hwxa_:

• d4hwxa_ first appeared in SCOPe 2.03
  
• d4hwxa_ appears in SCOPe 2.04
  
• d4hwxa_ is called d4hwxa1 in SCOPe 2.06
  
• d4hwxa_ appears in the current release, SCOPe 2.08, called d4hwxa1