PDB entry 4hwx

View 4hwx on RCSB PDB site
Description: Crystal structure of Streptomyces caespitosus sermetstatin
Class: Hydrolase Inhibitor
Keywords: Streptomyces subtilisin inhibitor fold, Hydrolase Inhibitor
Deposited on 2012-11-09, released 2012-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutral proteinase inhibitor ScNPI
    Species: Streptomyces caespitosus [TaxId:53502]
    Gene: ScNPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FDS0 (1-113)
      • expression tag (0)
    Domains in SCOPe 2.05: d4hwxa_
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hwxA (A:)
    gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
    laapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf