SCOPe 2.07: Domain d4ho9b_: 4ho9 B:

Lineage for d4ho9b_ (4ho9 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
   automatically mapped to Pfam PF00483

6. Protein RmlA (RfbA) [53465] (5 species)

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries)

8. Domain d4ho9b_: 4ho9 B: [234680]
   automated match to d4ho9a_
   complexed with gdu, so4, utp

Details for d4ho9b_

PDB Entry: 4ho9, 1.8 Å

PDB Description: crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp

PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4ho9b_:

Sequence; same for both SEQRES and ATOM records:

>d4ho9b_ c.68.1.6 (B:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr
feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell
qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv
vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti
ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahr

Timeline for d4ho9b_:

• d4ho9b_ first appeared in SCOPe 2.03
  
• d4ho9b_ appears in SCOPe 2.06
  
• d4ho9b_ appears in the current release, SCOPe 2.08