Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein RmlA (RfbA) [53465] (5 species) |
Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries) |
Domain d4ho9a_: 4ho9 A: [228439] automated match to d1lvwc_ complexed with gdu, so4, utp |
PDB Entry: 4ho9 (more details), 1.8 Å
SCOPe Domain Sequences for d4ho9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ho9a_ c.68.1.6 (A:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]} mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahrskdlvt
Timeline for d4ho9a_: