Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (7 species) not a true protein |
Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries) |
Domain d4ggza_: 4ggz A: [234471] automated match to d4jnja_ complexed with btn |
PDB Entry: 4ggz (more details), 1.75 Å
SCOPe Domain Sequences for d4ggza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggza_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]} lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw
Timeline for d4ggza_: