Lineage for d4ggza_ (4ggz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1553118Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1553119Protein automated matches [190537] (7 species)
    not a true protein
  7. 1553120Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)
  8. 1553121Domain d4ggza_: 4ggz A: [234471]
    automated match to d4jnja_
    complexed with btn

Details for d4ggza_

PDB Entry: 4ggz (more details), 1.75 Å

PDB Description: The structure of bradavidin2-biotin complex
PDB Compounds: (A:) Bradavidin 2

SCOPe Domain Sequences for d4ggza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggza_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

SCOPe Domain Coordinates for d4ggza_:

Click to download the PDB-style file with coordinates for d4ggza_.
(The format of our PDB-style files is described here.)

Timeline for d4ggza_: