SCOPe 2.05: Domain d4ggza_: 4ggz A:

Lineage for d4ggza_ (4ggz A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)

8. Domain d4ggza_: 4ggz A: [234471]
   automated match to d4jnja_
   complexed with btn

Details for d4ggza_

PDB Entry: 4ggz, 1.75 Å

PDB Description: The structure of bradavidin2-biotin complex

PDB Compounds: (A:) Bradavidin 2

SCOPe Domain Sequences for d4ggza_:

Sequence; same for both SEQRES and ATOM records:

>d4ggza_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

Timeline for d4ggza_:

• d4ggza_ first appeared in SCOPe 2.03
  
• d4ggza_ appears in SCOPe 2.04
  
• d4ggza_ appears in SCOPe 2.06
  
• d4ggza_ appears in the current release, SCOPe 2.08