Lineage for d4dk4b_ (4dk4 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753119Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 1753120Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 1753198Family a.204.1.0: automated matches [191410] (1 protein)
    not a true family
  6. 1753199Protein automated matches [190562] (4 species)
    not a true protein
  7. 1753214Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234324] (2 PDB entries)
  8. 1753217Domain d4dk4b_: 4dk4 B: [234326]
    automated match to d1ogla_
    complexed with ca, dun, na

Details for d4dk4b_

PDB Entry: 4dk4 (more details), 1.9 Å

PDB Description: Crystal Structure of Trypanosoma brucei dUTPase with dUpNp, Ca2+ and Na+
PDB Compounds: (B:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d4dk4b_:

Sequence, based on SEQRES records: (download)

>d4dk4b_ a.204.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaqp
dlqnvkieltdilhfslsgamqvsdensgavhkaeagsngesgkhwcyfdqpralpaagg
aeyvacvetpgsslsapvsadecdladfmffplsdtnnalasfqniirlaslqrfqlvts
aviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsld
dvtnegnyktkwddimhrvydafgtpkeerlnighwl

Sequence, based on observed residues (ATOM records): (download)

>d4dk4b_ a.204.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaqp
dlqnvkieltdilhfslsgamqvdladfmffplsdtnnalasfqniirlaslqrfqlvts
aviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsld
dvtnegnyktkwddimhrvydafgtpkeerlnighwl

SCOPe Domain Coordinates for d4dk4b_:

Click to download the PDB-style file with coordinates for d4dk4b_.
(The format of our PDB-style files is described here.)

Timeline for d4dk4b_: