![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
![]() | Protein automated matches [190562] (4 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234324] (2 PDB entries) |
![]() | Domain d4dk4b_: 4dk4 B: [234326] automated match to d1ogla_ complexed with ca, dun, na |
PDB Entry: 4dk4 (more details), 1.9 Å
SCOPe Domain Sequences for d4dk4b_:
Sequence, based on SEQRES records: (download)
>d4dk4b_ a.204.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} lsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaqp dlqnvkieltdilhfslsgamqvsdensgavhkaeagsngesgkhwcyfdqpralpaagg aeyvacvetpgsslsapvsadecdladfmffplsdtnnalasfqniirlaslqrfqlvts aviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsld dvtnegnyktkwddimhrvydafgtpkeerlnighwl
>d4dk4b_ a.204.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} lsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaqp dlqnvkieltdilhfslsgamqvdladfmffplsdtnnalasfqniirlaslqrfqlvts aviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsld dvtnegnyktkwddimhrvydafgtpkeerlnighwl
Timeline for d4dk4b_: