Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (7 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries) |
Domain d4cc4c1: 4cc4 C:34-219 [234304] Other proteins in same PDB: d4cc4a2, d4cc4b_, d4cc4c2, d4cc4d_, d4cc4e2, d4cc4f_ automated match to d4cc4e1 complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4c1 c.10.2.0 (C:34-219) automated matches {Listeria monocytogenes [TaxId: 169963]} sesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagm qfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelr dtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidl tgqkcv
Timeline for d4cc4c1: