Lineage for d4cc4c1 (4cc4 C:35-219)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851993Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries)
  8. 2851998Domain d4cc4c1: 4cc4 C:35-219 [234304]
    Other proteins in same PDB: d4cc4a2, d4cc4a3, d4cc4b1, d4cc4b2, d4cc4b3, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4d1, d4cc4d2, d4cc4e2, d4cc4f1, d4cc4f2, d4cc4f3
    automated match to d4cc4e1
    complexed with cl, gol, pe4, po4, so4

Details for d4cc4c1

PDB Entry: 4cc4 (more details), 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
PDB Compounds: (C:) inlc protein

SCOPe Domain Sequences for d4cc4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cc4c1 c.10.2.0 (C:35-219) automated matches {Listeria monocytogenes [TaxId: 169963]}
esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
gqkcv

SCOPe Domain Coordinates for d4cc4c1:

Click to download the PDB-style file with coordinates for d4cc4c1.
(The format of our PDB-style files is described here.)

Timeline for d4cc4c1: