SCOPe 2.07: Domain d4axmi_: 4axm I:

Lineage for d4axmi_ (4axm I:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries)

8. Domain d4axmi_: 4axm I: [234110]
   automated match to d2xu3a_
   complexed with gol, v65

Details for d4axmi_

PDB Entry: 4axm, 2.8 Å

PDB Description: triazine cathepsin inhibitor complex

PDB Compounds: (I:) Cathepsin L1

SCOPe Domain Sequences for d4axmi_:

Sequence, based on SEQRES records:

>d4axmi_ d.3.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records):

>d4axmi_ d.3.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnnkyw
lvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d4axmi_:

• d4axmi_ first appeared in SCOPe 2.03
  
• d4axmi_ appears in SCOPe 2.06
  
• d4axmi_ appears in the current release, SCOPe 2.08