Lineage for d4axmf_ (4axm F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2534862Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries)
  8. 2534909Domain d4axmf_: 4axm F: [234107]
    automated match to d2xu3a_
    complexed with gol, v65

Details for d4axmf_

PDB Entry: 4axm (more details), 2.8 Å

PDB Description: triazine cathepsin inhibitor complex
PDB Compounds: (F:) Cathepsin L1

SCOPe Domain Sequences for d4axmf_:

Sequence, based on SEQRES records: (download)

>d4axmf_ d.3.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d4axmf_ d.3.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnnkywl
vknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d4axmf_:

Click to download the PDB-style file with coordinates for d4axmf_.
(The format of our PDB-style files is described here.)

Timeline for d4axmf_: