Lineage for d3vxtb2 (3vxt B:113-241)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520205Domain d3vxtb2: 3vxt B:113-241 [233890]
    Other proteins in same PDB: d3vxta2, d3vxtc2
    automated match to d3vxtd2

Details for d3vxtb2

PDB Entry: 3vxt (more details), 2.5 Å

PDB Description: t36-5 tcr specific for hla-a24-nef134-10
PDB Compounds: (B:) T36-5 TCR beta chain

SCOPe Domain Sequences for d3vxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxtb2 b.1.1.0 (B:113-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3vxtb2:

Click to download the PDB-style file with coordinates for d3vxtb2.
(The format of our PDB-style files is described here.)

Timeline for d3vxtb2: