Lineage for d3uv5a1 (3uv5 A:1398-1518)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1487970Domain d3uv5a1: 3uv5 A:1398-1518 [233805]
    Other proteins in same PDB: d3uv5a2
    automated match to d1eqfa1
    complexed with trs

Details for d3uv5a1

PDB Entry: 3uv5 (more details), 2.03 Å

PDB Description: Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1)
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d3uv5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uv5a1 a.29.2.0 (A:1398-1518) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyykiitrpmdlqtlrenvrk
rlypsreefrehlelivknsatyngpkhsltqisqsmldlcdeklkekedklarlekain
p

SCOPe Domain Coordinates for d3uv5a1:

Click to download the PDB-style file with coordinates for d3uv5a1.
(The format of our PDB-style files is described here.)

Timeline for d3uv5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uv5a2