SCOPe 2.03: Domain d3uv5a1: 3uv5 A:1398-1518

Lineage for d3uv5a1 (3uv5 A:1398-1518)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)

8. Domain d3uv5a1: 3uv5 A:1398-1518 [233805]
   Other proteins in same PDB: d3uv5a2
   automated match to d1eqfa1
   complexed with trs

Details for d3uv5a1

PDB Entry: 3uv5, 2.03 Å

PDB Description: Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1)

PDB Compounds: (A:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d3uv5a1:

Sequence; same for both SEQRES and ATOM records:

>d3uv5a1 a.29.2.0 (A:1398-1518) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyykiitrpmdlqtlrenvrk
rlypsreefrehlelivknsatyngpkhsltqisqsmldlcdeklkekedklarlekain
p

Timeline for d3uv5a1:

• d3uv5a1 is new in SCOPe 2.03-stable
  
• d3uv5a1 appears in SCOPe 2.04
  
• d3uv5a1 appears in the current release, SCOPe 2.08