| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Ethr repressor [109978] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
| Domain d3tp3a2: 3tp3 A:95-215 [233704] Other proteins in same PDB: d3tp3a1 automated match to d1t56a2 mutant |
PDB Entry: 3tp3 (more details), 1.86 Å
SCOPe Domain Sequences for d3tp3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tp3a2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtwinvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n
Timeline for d3tp3a2: