Lineage for d3tp3a1 (3tp3 A:22-94)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Ethr repressor [109651] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
Uniprot P96222 22-215
Domain d3tp3a1: 3tp3 A:22-94 [233700]
Other proteins in same PDB: d3tp3a2
automated match to d1t56a1
mutant
Details for d3tp3a1
PDB Entry: 3tp3 (more details), 1.86 Å
PDB Description: structure of hth-type transcriptional regulator ethr, g106w mutant
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d3tp3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tp3a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
SCOPe Domain Coordinates for d3tp3a1:
Click to download the PDB-style file with coordinates for d3tp3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tp3a1:
- d3tp3a1 first appeared in SCOPe 2.03
- d3tp3a1 appears in SCOPe 2.07
View in 3D
