SCOPe 2.04: Domain d3ti2c_: 3ti2 C:

Lineage for d3ti2c_ (3ti2 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
   duplication: 6 repeats of this fold are organized in two RPTC-like domains
   automatically mapped to Pfam PF00275

6. Protein automated matches [190917] (7 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [233681] (1 PDB entry)

8. Domain d3ti2c_: 3ti2 C: [233686]
   automated match to d1p89a_
   complexed with cl, pg4

Details for d3ti2c_

PDB Entry: 3ti2, 1.9 Å

PDB Description: 1.90 angstrom resolution crystal structure of n-terminal domain 3- phosphoshikimate 1-carboxyvinyltransferase from vibrio cholerae

PDB Compounds: (C:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3ti2c_:

Sequence; same for both SEQRES and ATOM records:

>d3ti2c_ d.68.2.2 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
vnlpgsksvsnralllaalasgttrltnlldsddirhmlnaltklgvnyrlsadkttcev
eglgqafhttqplelflgnagtamrplaaalclgqgdyvltgeprmkerpighlvdalrq
agaqieyleqenfpplriqgtglqagtvtidgsissqfltaflmsaplaqgkvtikivge
lvskpyiditlhimeqfgvqvinhdyqefvipagqsyvspgqflvegd

Timeline for d3ti2c_:

• d3ti2c_ first appeared in SCOPe 2.03
  
• d3ti2c_ appears in SCOPe 2.05
  
• d3ti2c_ appears in the current release, SCOPe 2.08