Lineage for d3ti2a_ (3ti2 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656184Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1656194Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 1656326Protein automated matches [190917] (7 species)
    not a true protein
  7. 1656368Species Vibrio cholerae [TaxId:243277] [233681] (1 PDB entry)
  8. 1656369Domain d3ti2a_: 3ti2 A: [233685]
    automated match to d1p89a_
    complexed with cl, pg4

Details for d3ti2a_

PDB Entry: 3ti2 (more details), 1.9 Å

PDB Description: 1.90 angstrom resolution crystal structure of n-terminal domain 3- phosphoshikimate 1-carboxyvinyltransferase from vibrio cholerae
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3ti2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ti2a_ d.68.2.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nlpgsksvsnralllaalasgttrltnlldsddirhmlnaltklgvnyrlsadkttceve
glgqafhttqplelflgnagtamrplaaalclgqgdyvltgeprmkerpighlvdalrqa
gaqieyleqenfpplriqgtglqagtvtidgsissqfltaflmsaplaqgkvtikivgel
vskpyiditlhimeqfgvqvinhdyqefvipagqsyvspgqflvegd

SCOPe Domain Coordinates for d3ti2a_:

Click to download the PDB-style file with coordinates for d3ti2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ti2a_: