Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) |
Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins) duplication: 6 repeats of this fold are organized in two RPTC-like domains automatically mapped to Pfam PF00275 |
Protein automated matches [190917] (7 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [233681] (1 PDB entry) |
Domain d3ti2a_: 3ti2 A: [233685] automated match to d1p89a_ complexed with cl, pg4 |
PDB Entry: 3ti2 (more details), 1.9 Å
SCOPe Domain Sequences for d3ti2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ti2a_ d.68.2.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} nlpgsksvsnralllaalasgttrltnlldsddirhmlnaltklgvnyrlsadkttceve glgqafhttqplelflgnagtamrplaaalclgqgdyvltgeprmkerpighlvdalrqa gaqieyleqenfpplriqgtglqagtvtidgsissqfltaflmsaplaqgkvtikivgel vskpyiditlhimeqfgvqvinhdyqefvipagqsyvspgqflvegd
Timeline for d3ti2a_: