SCOPe 2.08: Domain d3t62f_: 3t62 F:

Lineage for d3t62f_ (3t62 F:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries)

8. Domain d3t62f_: 3t62 F: [233666]
   Other proteins in same PDB: d3t62a_, d3t62b_, d3t62c_
   automated match to d3m7qb_
   complexed with so4

Details for d3t62f_

PDB Entry: 3t62, 2 Å

PDB Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean Sea anemone Stichodactyla helianthus in complex with bovine chymotrypsin

PDB Compounds: (F:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3t62f_:

Sequence; same for both SEQRES and ATOM records:

>d3t62f_ g.8.1.1 (F:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr

Timeline for d3t62f_:

• d3t62f_ first appeared in SCOPe 2.03
  
• d3t62f_ appears in SCOPe 2.07