PDB entry 3t62

View 3t62 on RCSB PDB site
Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean Sea anemone Stichodactyla helianthus in complex with bovine chymotrypsin
Class: hydrolase/hydrolase inhibitor
Keywords: chymotrypsin-inhibitor complex, Kunitz-type serine protease inhibitor, secreted, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-07-28, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62a_
  • Chain 'B':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62b_
  • Chain 'C':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62c_
  • Chain 'D':
    Compound: Kunitz-type proteinase inhibitor SHPI-1
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62d_
  • Chain 'E':
    Compound: Kunitz-type proteinase inhibitor SHPI-1
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62e_
  • Chain 'F':
    Compound: Kunitz-type proteinase inhibitor SHPI-1
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t62f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t62A (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t62A (A:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t62B (B:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t62B (B:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t62C (C:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t62C (C:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t62D (D:)
    sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t62E (E:)
    sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t62F (F:)
    sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr