Lineage for d1cn3e_ (1cn3 E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107470Protein Murine polyomavirus coat protein vp1 [49657] (1 species)
  7. 107471Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)
  8. 107486Domain d1cn3e_: 1cn3 E: [23350]

Details for d1cn3e_

PDB Entry: 1cn3 (more details), 2.2 Å

PDB Description: interaction of polyomavirus internal protein vp2 with major capsid protein vp1 and implications for participation of vp2 in viral entry

SCOP Domain Sequences for d1cn3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn3e_ b.10.1.4 (E:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16}
mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

SCOP Domain Coordinates for d1cn3e_:

Click to download the PDB-style file with coordinates for d1cn3e_.
(The format of our PDB-style files is described here.)

Timeline for d1cn3e_: