SCOP 1.59: Domain d1cn3d_: 1cn3 D:

Lineage for d1cn3d_ (1cn3 D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Murine polyomavirus coat protein vp1 [49657] (1 species)

7. Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries)

8. Domain d1cn3d_: 1cn3 D: [23349]

Details for d1cn3d_

PDB Entry: 1cn3, 2.2 Å

PDB Description: interaction of polyomavirus internal protein vp2 with major capsid protein vp1 and implications for participation of vp2 in viral entry

SCOP Domain Sequences for d1cn3d_:

Sequence; same for both SEQRES and ATOM records:

>d1cn3d_ b.10.1.4 (D:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16}
mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

Timeline for d1cn3d_:

• d1cn3d_ first appeared (with stable ids) in SCOP 1.55
  
• d1cn3d_ appears in SCOP 1.57
  
• d1cn3d_ appears in SCOP 1.61
  
• d1cn3d_ appears in the current release, SCOPe 2.08