![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) ![]() |
![]() | Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
![]() | Protein Polyomavirus coat proteins [49657] (2 species) |
![]() | Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries) |
![]() | Domain d1cn3a_: 1cn3 A: [23346] |
PDB Entry: 1cn3 (more details), 2.2 Å
SCOPe Domain Sequences for d1cn3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cn3a_ b.121.6.1 (A:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]} mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
Timeline for d1cn3a_:
![]() Domains from other chains: (mouse over for more information) d1cn3b_, d1cn3c_, d1cn3d_, d1cn3e_ |