Lineage for d3rbbd_ (3rbb D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536554Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1536555Protein automated matches [190457] (8 species)
    not a true protein
  7. 1536598Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)
  8. 1536646Domain d3rbbd_: 3rbb D: [233425]
    Other proteins in same PDB: d3rbba_, d3rbbc_
    automated match to d1h92a_
    complexed with edo

Details for d3rbbd_

PDB Entry: 3rbb (more details), 2.35 Å

PDB Description: HIV-1 NEF protein in complex with engineered HCK SH3 domain
PDB Compounds: (D:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3rbbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rbbd_ b.34.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd

SCOPe Domain Coordinates for d3rbbd_:

Click to download the PDB-style file with coordinates for d3rbbd_.
(The format of our PDB-style files is described here.)

Timeline for d3rbbd_: