SCOPe 2.07: Domain d3qvea1: 3qve A:206-342

Lineage for d3qvea1 (3qve A:206-342)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.0: automated matches [233360] (1 protein)
   not a true family

6. Protein automated matches [233361] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233362] (1 PDB entry)

8. Domain d3qvea1: 3qve A:206-342 [233367]
   Other proteins in same PDB: d3qvea2, d3qveb2, d3qvec2
   automated match to d4aqpb_
   complexed with edo, so4

Details for d3qvea1

PDB Entry: 3qve, 2.04 Å

PDB Description: Crystal structure of human HMG box-containing protein 1, HBP1

PDB Compounds: (A:) HMG box-containing protein 1

SCOPe Domain Sequences for d3qvea1:

Sequence, based on SEQRES records:

>d3qvea1 b.145.1.0 (A:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swpstvwhcflkgtrlcfhkgsnkewqdvedfaraegcdneedlqmgihkgygsdglkll
sheesvsfgesvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipc
cevhigdvclppghpda

Sequence, based on observed residues (ATOM records):

>d3qvea1 b.145.1.0 (A:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swpstvwhcflkgtrlcfhkgsnkewqdvedfaraeggihkgygsdglkllsheesvsfg
esvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipccevhigdvc
lppghpda

Timeline for d3qvea1:

• d3qvea1 first appeared in SCOPe 2.03, called d3qvea_
  
• d3qvea1 appears in SCOPe 2.06
  
• d3qvea1 appears in the current release, SCOPe 2.08