Lineage for d3qveb1 (3qve B:206-342)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433745Fold b.145: AXH domain [102030] (1 superfamily)
    pseudobarrel; some similarity to OB-fold
  4. 2433746Superfamily b.145.1: AXH domain [102031] (2 families) (S)
    automatically mapped to Pfam PF08517
  5. 2433769Family b.145.1.0: automated matches [233360] (1 protein)
    not a true family
  6. 2433770Protein automated matches [233361] (2 species)
    not a true protein
  7. 2433771Species Human (Homo sapiens) [TaxId:9606] [233362] (1 PDB entry)
  8. 2433773Domain d3qveb1: 3qve B:206-342 [233365]
    Other proteins in same PDB: d3qvea2, d3qveb2, d3qvec2
    automated match to d4aqpb_
    complexed with edo, so4

Details for d3qveb1

PDB Entry: 3qve (more details), 2.04 Å

PDB Description: Crystal structure of human HMG box-containing protein 1, HBP1
PDB Compounds: (B:) HMG box-containing protein 1

SCOPe Domain Sequences for d3qveb1:

Sequence, based on SEQRES records: (download)

>d3qveb1 b.145.1.0 (B:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swpstvwhcflkgtrlcfhkgsnkewqdvedfaraegcdneedlqmgihkgygsdglkll
sheesvsfgesvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipc
cevhigdvclppghpda

Sequence, based on observed residues (ATOM records): (download)

>d3qveb1 b.145.1.0 (B:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swpstvwhcflkgtrlcfhkgsnkewqdvedfaraeggihkgygsdglkllsheesvsfg
esvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipccevhigdvc
lppghpda

SCOPe Domain Coordinates for d3qveb1:

Click to download the PDB-style file with coordinates for d3qveb1.
(The format of our PDB-style files is described here.)

Timeline for d3qveb1: