Class b: All beta proteins [48724] (178 folds) |
Fold b.145: AXH domain [102030] (1 superfamily) pseudobarrel; some similarity to OB-fold |
Superfamily b.145.1: AXH domain [102031] (2 families) automatically mapped to Pfam PF08517 |
Family b.145.1.0: automated matches [233360] (1 protein) not a true family |
Protein automated matches [233361] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233362] (1 PDB entry) |
Domain d3qveb1: 3qve B:206-342 [233365] Other proteins in same PDB: d3qvea2, d3qveb2, d3qvec2 automated match to d4aqpb_ complexed with edo, so4 |
PDB Entry: 3qve (more details), 2.04 Å
SCOPe Domain Sequences for d3qveb1:
Sequence, based on SEQRES records: (download)
>d3qveb1 b.145.1.0 (B:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]} swpstvwhcflkgtrlcfhkgsnkewqdvedfaraegcdneedlqmgihkgygsdglkll sheesvsfgesvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipc cevhigdvclppghpda
>d3qveb1 b.145.1.0 (B:206-342) automated matches {Human (Homo sapiens) [TaxId: 9606]} swpstvwhcflkgtrlcfhkgsnkewqdvedfaraeggihkgygsdglkllsheesvsfg esvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipccevhigdvc lppghpda
Timeline for d3qveb1:
View in 3D Domains from other chains: (mouse over for more information) d3qvea1, d3qvea2, d3qvec1, d3qvec2 |