Lineage for d3qq7a2 (3qq7 A:107-187)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186568Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186569Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2186570Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2186585Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2186586Species Human (Homo sapiens) [TaxId:9606] [233318] (12 PDB entries)
  8. 2186594Domain d3qq7a2: 3qq7 A:107-187 [233349]
    Other proteins in same PDB: d3qq7a1
    automated match to d1e32a3
    complexed with cl, co, gol, hez

Details for d3qq7a2

PDB Entry: 3qq7 (more details), 2.65 Å

PDB Description: crystal structure of the p97 n-terminal domain
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3qq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq7a2 d.31.1.1 (A:107-187) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcege

SCOPe Domain Coordinates for d3qq7a2:

Click to download the PDB-style file with coordinates for d3qq7a2.
(The format of our PDB-style files is described here.)

Timeline for d3qq7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qq7a1