| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) ![]() |
| Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) |
| Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries) |
| Domain d3qq7a2: 3qq7 A:107-187 [233349] Other proteins in same PDB: d3qq7a1 automated match to d1e32a3 complexed with cl, co, gol, hez |
PDB Entry: 3qq7 (more details), 2.65 Å
SCOPe Domain Sequences for d3qq7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq7a2 d.31.1.1 (A:107-187) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcege
Timeline for d3qq7a2: