![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
![]() | Protein automated matches [227009] (9 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries) |
![]() | Domain d3qnaa_: 3qna A: [233344] automated match to d3qn0a_ complexed with bio, zn |
PDB Entry: 3qna (more details), 2.5 Å
SCOPe Domain Sequences for d3qnaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qnaa_ d.96.1.0 (A:) automated matches {Escherichia coli [TaxId: 469008]} sttlfkdftfeaahrlphvpeghkagrlhghsfmvrleitgevdphtgwiidfaelkaaf kptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrg
Timeline for d3qnaa_: