Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
Protein automated matches [190458] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries) |
Domain d3ppea1: 3ppe A:1-97 [233261] automated match to d3lndd1 complexed with ca |
PDB Entry: 3ppe (more details), 2.1 Å
SCOPe Domain Sequences for d3ppea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ppea1 b.1.6.0 (A:1-97) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dwiwnrmhireeidsplphhvgkltssvgnknamyiiegesantifkvqgydgdiyafer ldrekkaeyeltahiidrrnnrsleppskfiikvsdi
Timeline for d3ppea1: