SCOPe 2.06: Domain d3ppea1: 3ppe A:1-97

Lineage for d3ppea1 (3ppe A:1-97)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)

8. Domain d3ppea1: 3ppe A:1-97 [233261]
   automated match to d3lndd1
   complexed with ca

Details for d3ppea1

PDB Entry: 3ppe, 2.1 Å

PDB Description: Crystal structure of chicken VE-cadherin EC1-2

PDB Compounds: (A:) Vascular endothelial cadherin

SCOPe Domain Sequences for d3ppea1:

Sequence; same for both SEQRES and ATOM records:

>d3ppea1 b.1.6.0 (A:1-97) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dwiwnrmhireeidsplphhvgkltssvgnknamyiiegesantifkvqgydgdiyafer
ldrekkaeyeltahiidrrnnrsleppskfiikvsdi

Timeline for d3ppea1:

• d3ppea1 first appeared in SCOPe 2.03
  
• d3ppea1 appears in SCOPe 2.05
  
• d3ppea1 appears in SCOPe 2.07
  
• d3ppea1 appears in the current release, SCOPe 2.08