Lineage for d3phza1 (3phz A:2-148)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316851Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1316852Protein automated matches [226913] (4 species)
    not a true protein
  7. 1316853Species Polyporus squamosus [TaxId:5640] [233243] (1 PDB entry)
  8. 1316854Domain d3phza1: 3phz A:2-148 [233244]
    Other proteins in same PDB: d3phza2, d3phzb2
    automated match to d2ihoa1
    complexed with sia

Details for d3phza1

PDB Entry: 3phz (more details), 1.7 Å

PDB Description: crystal structure analysis of polyporus squamosus lectin bound to human-type influenza-binding epitope neu5aca2-6galb1-4glcnac
PDB Compounds: (A:) Ricin B-related lectin

SCOPe Domain Sequences for d3phza1:

Sequence, based on SEQRES records: (download)

>d3phza1 b.42.2.0 (A:2-148) automated matches {Polyporus squamosus [TaxId: 5640]}
sfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadtyt
vrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtlln
gdgggtgtvvgwqnitnntsqnwtfqk

Sequence, based on observed residues (ATOM records): (download)

>d3phza1 b.42.2.0 (A:2-148) automated matches {Polyporus squamosus [TaxId: 5640]}
sfqghgiyyiasayvantrlalsenkspdviissdavdplnnlwliepvgeadtytvrna
fagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtllnggtg
tvvgwqnitnntsqnwtfqk

SCOPe Domain Coordinates for d3phza1:

Click to download the PDB-style file with coordinates for d3phza1.
(The format of our PDB-style files is described here.)

Timeline for d3phza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phza2