Lineage for d2ihoa1 (2iho A:2-155)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein Agglutinin MOA, N-terminal domain [159152] (1 species) Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159153] (2 PDB entries)
Uniprot Q8X123 2-155
Domain d2ihoa1: 2iho A:2-155 [147681]
Other proteins in same PDB: d2ihoa2
Details for d2ihoa1
PDB Entry: 2iho (more details), 2.41 Å
PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
PDB Compounds: (A:) lectinSCOPe Domain Sequences for d2ihoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
vdlvngdssdgakiagwtgtwdegnphqkwyfnr
SCOPe Domain Coordinates for d2ihoa1:
Click to download the PDB-style file with coordinates for d2ihoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ihoa1:
- d2ihoa1 first appeared in SCOP 1.75
- d2ihoa1 appears in SCOPe 2.02
- d2ihoa1 appears in SCOPe 2.04
- d2ihoa1 appears in the current release, SCOPe 2.08
View in 3D
