Lineage for d2ihoa2 (2iho A:156-293)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399658Family d.3.1.18: MOA C-terminal domain-like [159846] (1 protein)
    PfamB PB070855
  6. 1399659Protein Agglutinin MOA [159847] (1 species)
  7. 1399660Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries)
    Uniprot Q8X123 156-293
  8. 1399665Domain d2ihoa2: 2iho A:156-293 [147682]
    Other proteins in same PDB: d2ihoa1

Details for d2ihoa2

PDB Entry: 2iho (more details), 2.41 Å

PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2ihoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihoa2 d.3.1.18 (A:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy

SCOPe Domain Coordinates for d2ihoa2:

Click to download the PDB-style file with coordinates for d2ihoa2.
(The format of our PDB-style files is described here.)

Timeline for d2ihoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ihoa1