SCOPe 2.02: Domain d2ihoa2: 2iho A:156-293

Lineage for d2ihoa2 (2iho A:156-293)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.18: MOA C-terminal domain-like [159846] (1 protein)
   PfamB PB070855

6. Protein Agglutinin MOA [159847] (1 species)

7. Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (1 PDB entry)
   Uniprot Q8X123 156-293

8. Domain d2ihoa2: 2iho A:156-293 [147682]
   Other proteins in same PDB: d2ihoa1

Details for d2ihoa2

PDB Entry: 2iho, 2.41 Å

PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2ihoa2:

Sequence; same for both SEQRES and ATOM records:

>d2ihoa2 d.3.1.18 (A:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy

Timeline for d2ihoa2:

• d2ihoa2 first appeared in SCOP 1.75
  
• d2ihoa2 appears in SCOPe 2.01
  
• d2ihoa2 appears in SCOPe 2.03
  
• d2ihoa2 appears in the current release, SCOPe 2.08