SCOPe 2.03: Domain d3phza2: 3phz A:149-286

Lineage for d3phza2 (3phz A:149-286)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (14 species)
   not a true protein

7. Species Polyporus squamosus [TaxId:5640] [233246] (1 PDB entry)

8. Domain d3phza2: 3phz A:149-286 [233249]
   Other proteins in same PDB: d3phza1, d3phzb1
   automated match to d2ihoa2
   complexed with sia

Details for d3phza2

PDB Entry: 3phz, 1.7 Å

PDB Description: crystal structure analysis of polyporus squamosus lectin bound to human-type influenza-binding epitope neu5aca2-6galb1-4glcnac

PDB Compounds: (A:) Ricin B-related lectin

SCOPe Domain Sequences for d3phza2:

Sequence; same for both SEQRES and ATOM records:

>d3phza2 d.3.1.0 (A:149-286) automated matches {Polyporus squamosus [TaxId: 5640]}
lsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglgstpwrseifdc
ddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfvergnfstvtffepq
ngtysanawdykayfglf

Timeline for d3phza2:

• d3phza2 is new in SCOPe 2.03-stable
  
• d3phza2 appears in SCOPe 2.04
  
• d3phza2 appears in the current release, SCOPe 2.08