Lineage for d3pboa1 (3pbo A:58-221)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684037Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1684038Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 1684066Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 1684067Protein automated matches [226981] (7 species)
    not a true protein
  7. 1684078Species Pseudomonas aeruginosa [TaxId:208964] [228776] (12 PDB entries)
  8. 1684081Domain d3pboa1: 3pbo A:58-221 [233211]
    Other proteins in same PDB: d3pboa2
    automated match to d4kqoa1
    complexed with caz

Details for d3pboa1

PDB Entry: 3pbo (more details), 1.74 Å

PDB Description: Crystal structure of PBP3 complexed with ceftazidime
PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d3pboa1:

Sequence, based on SEQRES records: (download)

>d3pboa1 d.175.1.0 (A:58-221) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieqn
aerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgreg
ielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Sequence, based on observed residues (ATOM records): (download)

>d3pboa1 d.175.1.0 (A:58-221) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieqn
aerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgreg
ielafdewlagvpgakpgktlal

SCOPe Domain Coordinates for d3pboa1:

Click to download the PDB-style file with coordinates for d3pboa1.
(The format of our PDB-style files is described here.)

Timeline for d3pboa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pboa2