SCOPe 2.03: Domain d1cwpc_: 1cwp C:

Lineage for d1cwpc_ (1cwp C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry)

8. Domain d1cwpc_: 1cwp C: [23307]
   protein/RNA complex

Details for d1cwpc_

PDB Entry: 1cwp, 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy

PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1cwpc_:

Sequence; same for both SEQRES and ATOM records:

>d1cwpc_ b.121.4.5 (C:) Cucumovirus coat protein {Cowpea chlorotic mottle virus [TaxId: 12303]}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

Timeline for d1cwpc_:

• d1cwpc_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwpc_ appears in SCOPe 2.02
  
• d1cwpc_ appears in SCOPe 2.04
  
• d1cwpc_ appears in the current release, SCOPe 2.08