SCOPe 2.04: Domain d3ocib1: 3oci B:19-113

Lineage for d3ocib1 (3oci B:19-113)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (3 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)

8. Domain d3ocib1: 3oci B:19-113 [233069]
   automated match to d1ytba1
   complexed with edo

Details for d3ocib1

PDB Entry: 3oci, 1.9 Å

PDB Description: Crystal structure of TBP (TATA box binding protein)

PDB Compounds: (B:) transcription initiation factor tfiid (tfiid-1)

SCOPe Domain Sequences for d3ocib1:

Sequence; same for both SEQRES and ATOM records:

>d3ocib1 d.129.1.0 (B:19-113) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sgiiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgk
mvitgaksekssrmaaqryakiihklgfnatfddf

Timeline for d3ocib1:

• d3ocib1 first appeared in SCOPe 2.03
  
• d3ocib1 appears in SCOPe 2.05
  
• d3ocib1 appears in the current release, SCOPe 2.08